Basic Vector Information
- Vector Name:
- pANT1202
- Antibiotic Resistance:
- Apramycin
- Length:
- 6342 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- DeSanti CL, Strohl WR.
pANT1202 vector Vector Map
pANT1202 vector Sequence
LOCUS 40924_4529 6342 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pANT1202, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6342) AUTHORS DeSanti CL, Strohl WR. TITLE Characterization of the Streptomyces sp. strain C5 snp locus and development of snp-derived expression vectors JOURNAL Appl. Environ. Microbiol. 69 (3), 1647-1654 (2003) PUBMED 12620855 REFERENCE 2 (bases 1 to 6342) AUTHORS DeSanti CL, Strohl WR. TITLE Direct Submission JOURNAL Submitted (31-DEC-2001) School of Dentistry, Case Western Reserve University, 2123 Abington Rd, Cleveland, OH 44106, USA REFERENCE 3 (bases 1 to 6342) TITLE Direct Submission REFERENCE 4 (bases 1 to 6342) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2003"; volume: "69"; issue: "3"; pages: "1647-1654" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-DEC-2001) School of Dentistry, Case Western Reserve University, 2123 Abington Rd, Cleveland, OH 44106, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6342 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(191..1561) /codon_start=1 /product="replication protein pIJ101 Rep" /label=replication protein pIJ101 Rep /protein_id="AAL61989.1" /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDAAAVGERVREVLALADAADTVVVLTAG EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH" primer_bind 2846..2862 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(2917..3681) /label=ApmR /note="aminoglycoside 3-N-acetyltransferase type IV" primer_bind complement(3872..3888) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(3896..3912) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(3920..3950) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(3965..3986) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4274..4862) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 4967..5097 /label=multiple cloning site /note="multiple cloning site" regulatory complement(5097..5137) /label=snpA promoter /note="snpA promoter" /regulatory_class="promoter" CDS 5355..6296 /codon_start=1 /product="LysR-like transcriptional activator SnpR" /label=LysR-like transcriptional activator SnpR /protein_id="AAL61991.1" /translation="MELEVRHLRALCAIADTGSLHRAARQLGVTQPSLSTQLRRIEHEL GGALFVRARTGCRPTPLGRLVLSRARPLVAELRSLVSEARAAAVGGRQLRVGSTASRAL AGWLRRLRRHWQEPTLHMDVSANALLRMVADGHLDVAFVHEVEGSPLRVPEGLRVRVLV QREPQFVCLPADHPAAAKPSYASPTWPTTRWMIDPTVDGEWDAVRRVLRAEGLDPRILH GDYHTAASLVATGEVVTVVQPTSPSRAETAVRRLHGDPLGVRLLLAARTDTELEGVYPD LAEAYGEVARQAPAYREWLERSGSGALVPALP"
This page is informational only.