Basic Vector Information
- Vector Name:
- pANT1201
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6607 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- DeSanti CL, Strohl WR.
pANT1201 vector Map
pANT1201 vector Sequence
LOCUS 40924_4524 6607 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pANT1201, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6607) AUTHORS DeSanti CL, Strohl WR. TITLE Characterization of the Streptomyces sp. strain C5 snp locus and development of snp-derived expression vectors JOURNAL Appl. Environ. Microbiol. 69 (3), 1647-1654 (2003) PUBMED 12620855 REFERENCE 2 (bases 1 to 6607) AUTHORS DeSanti CL, Strohl WR. TITLE Direct Submission JOURNAL Submitted (31-DEC-2001) School of Dentistry, Case Western Reserve University, 2123 Abington Rd, Cleveland, OH 44106, USA REFERENCE 3 (bases 1 to 6607) TITLE Direct Submission REFERENCE 4 (bases 1 to 6607) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl. Environ. Microbiol."; date: "2003"; volume: "69"; issue: "3"; pages: "1647-1654" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (31-DEC-2001) School of Dentistry, Case Western Reserve University, 2123 Abington Rd, Cleveland, OH 44106, USA" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6607 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(156..1526) /codon_start=1 /product="replication protein pIJ101 Rep" /label=replication protein pIJ101 Rep /protein_id="AAL61986.1" /translation="MDPASGVIVAQTAAGTSVVLGLMRCGRIWLCPVCAATIRHKRAEE ITAAVVEWIKRGGTAYLVTFTARHGHTDRLADLMDALQGTRKTPDSPRRPGAYQRLITG GTWAGRRAKDGHRAADREGIRDRIGYVGMIRATEVTVGQINGWHPHIHAIVLVGGRTEG ERSAKQIVATFEPTGAALDEWQGHWRSVWTAALRKVNPAFTPDDRHGVDFKRLETERDA NDLAEYIAKTQDGKAPALELARADLKTATGGNVAPFELLGRIGDLTGGMTEDDAAGVGS LEWNLSRWHEYERATRGRRAIEWTRYLRQMLGLDGGDTEADDLDLLLAADADGGELRAG VAVTEDGWHAVTRRALDLEATRAAEGKDGNEDAAAVGERVREVLALADAADTVVVLTAG EVAEAYADMLAALAQRREEATARRRREQDDDQDDDADDRQERAARHIARLASGPTSH" primer_bind 2811..2827 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(3015..3806) /label=NeoR/KanR /note="aminoglycoside phosphotransferase" regulatory complement(3848..3888) /label=aprR promoter /note="aprR promoter" /regulatory_class="promoter" primer_bind complement(4102..4118) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4126..4142) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4150..4180) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4195..4216) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(4504..5092) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" misc_feature 5197..5327 /label=multiple cloning site /note="multiple cloning site" regulatory complement(5327..5367) /label=snpA promoter /note="snpA promoter" /regulatory_class="promoter" CDS 5585..6526 /codon_start=1 /product="LysR-like transcriptional activator SnpR" /label=LysR-like transcriptional activator SnpR /protein_id="AAL61988.1" /translation="MELEVRHLRALCAIADTGSLHRAARQLGVTQPSLSTQLRRIEHEL GGALFVRARTGCRPTPLGRLVLSRARPLVAELRSLVSEARAAAVGGRQLRVGSTASRAL AGWLRRLRRHWQEPTLHMDVSANALLRMVADGHLDVAFVHEVEGSPLRVPEGLRVRVLV QREPQFVCLPADHPAAAKPSYASPTWPTTRWMIDPTVDGEWDAVRRVLRAEGLDPRILH GDYHTAASLVATGEVVTVVQPTSPSRAETAVRRLHGDPLGVRLLLAARTDTELEGVYPD LAEAYGEVARQAPAYREWLERSGSGALVPALP"
This page is informational only.