pcDNA3-AQP4d vector (Cat. No.: V008601)
Basic Information
- Name:
- pcDNA3-AQP4d
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6349 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Moe SE, Sorbo JG, Sogaard R, Zeuthen T, Petter Ottersen O, Holen T.
- Promoter:
- SP6
pcDNA3-AQP4d vector (Cat. No.: V008601) Sequence
LOCUS 40924_9916 6349 bp DNA circular SYN 17-DEC-2018
DEFINITION Expression vector pcDNA3-AQP4d, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6349)
AUTHORS Moe SE, Sorbo JG, Sogaard R, Zeuthen T, Petter Ottersen O, Holen T.
TITLE New isoforms of rat Aquaporin-4
JOURNAL Genomics 91 (4), 367-377 (2008)
PUBMED 18255256
REFERENCE 2 (bases 1 to 6349)
AUTHORS Sorbo JG, Moe SE, Holen TV.
TITLE New Isoforms of Rat Aquaporin-4
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 6349)
AUTHORS Sorbo JG, Moe SE, Holen TV.
TITLE Direct Submission
JOURNAL Submitted (11-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9,
Oslo, no 0317, Norway
REFERENCE 4 (bases 1 to 6349)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6349)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Genomics";
date: "2008"; volume: "91"; issue: "4"; pages: "367-377"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(11-FEB-2007) CMBN, University of Oslo, Sognsvannsveien 9, Oslo, no
0317, Norway"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6349
/mol_type="other DNA"
/organism="synthetic DNA construct"
enhancer 235..614
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
promoter 615..818
/label=CMV promoter
/note="human cytomegalovirus (CMV) immediate early
promoter"
promoter 863..881
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 1049..1789
/codon_start=1
/product="AQP4d"
/label=AQP4d
/note="aquaporin-4 isoform; derived from Rattus norvegicus
strain PVG"
/protein_id="ABO09754.1"
/translation="MVAFKGVWTQAFWKAVTAEFLAMLIFVLLSVGSTINWGGSENPLP
VDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRKISIAKSVFYITAQCLGA
IIGAGILYLVTPPSVVGGLGVTTINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG
AVLAGALYEYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVV
HVIDIDRGDEKKGKDSSGEVLSSV"
regulatory 1226..1235
/note="vertebrate consensus sequence for strong initiation
of translation (Kozak, 1987)"
/regulatory_class="other"
promoter complement(1901..1919)
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
polyA_signal 1945..2169
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
rep_origin 2215..2643
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
promoter 2657..2987
/label=SV40 promoter
/note="SV40 enhancer and early promoter"
CDS 3054..3845
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
polyA_signal 4022..4155
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
primer_bind complement(4192..4208)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(4216..4232)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(4240..4270)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(4285..4306)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4594..5182)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(5356..6213)
/label=AmpR
/note="beta-lactamase"
promoter complement(6214..6318)
/label=AmpR promoter
This page is informational only.