Basic Vector Information
- Vector Name:
- pCAGGS-FLAGmA20f2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6694 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-FLAGmA20f2 vector Map
pCAGGS-FLAGmA20f2 vector Sequence
LOCUS 40924_8376 6694 bp DNA circular SYN 17-DEC-2018 DEFINITION Mammalian expression vector pCAGGS-FLAGmA20f2, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 6694) AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R. TITLE BCCM/LMBP Plasmid collection JOURNAL Unpublished REFERENCE 2 (bases 1 to 6694) AUTHORS De Schamphelaire W. TITLE Direct Submission JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM REFERENCE 3 (bases 1 to 6694) TITLE Direct Submission REFERENCE 4 (bases 1 to 6694) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927, 9052, BELGIUM" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..6694 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 13..36 /label=FLAG /note="FLAG(R) epitope tag, followed by an enterokinase cleavage site" CDS 46..1965 /codon_start=1 /note="unnamed protein product; mA20 (1-640)" /protein_id="SJL88080.1" /translation="MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIYHFKTMHR YTLEMFRTCQFCPQFREIIHKALIDRSVQASLESQKKLNWCREVRKLVALKTNGDGNCL MHAACQYMWGVQDTDLVLRKALCSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRN WNDEWDNLVKMASADTPAARSGLQYNSLEEIHIFVLSNILRRPIIVISDKMLRSLESGS NFAPLKVGGIYLPLHWPAQECYRYPIVLGYDSQHFVPLVTLKDSGPELRAVPLVNRDRG RFEDLKVHFLTDPENEMKEKLLKEYLIVMEIPVQGWDHGTTHLINAAKLDEANLPKEIN LVDDYFELVQHEYKKWQENSDQARRAAHAQNPLEPSTPQLSLMDIKCETPNCPFFMSVN TQPLCHECSERRQKNQSKLPKLNSKLGPEGLPGVGLGSSNWSPEETAGGPHSAPPTAPS LFLFSETTAMKCRSPGCPFTLNVQHNGFCERCHARQINASHTADPGKCQACLQDVTRTF NGICSTCFKRTTAEPSSSLTSSIPASCHQRSKSDPSQLIQSLTPHSCHRTGNVSPSGCL SQAARTPGDRAGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASAKAGSPAPR FQNNV" polyA_signal 2047..2102 /label=beta-globin poly(A) signal /note="rabbit beta-globin polyadenylation signal (Gil and Proudfoot, 1987)" primer_bind complement(2463..2479) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(2487..2503) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(2511..2541) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(2555..2576) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 2634..2830 /label=SV40 promoter /note="SV40 early promoter" polyA_signal 2836..2970 /label=SV40 poly(A) signal /note="SV40 polyadenylation signal" rep_origin complement(3208..3796) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(3970..4827) /label=AmpR /note="beta-lactamase" promoter complement(4828..4932) /label=AmpR promoter enhancer 4967..5346 /label=CMV enhancer /note="human cytomegalovirus immediate early enhancer" regulatory 4967..5344 /label=hCMV-IE enhancer /note="hCMV-IE enhancer" /regulatory_class="promoter" promoter 5348..5625 /label=chicken beta-actin promoter intron 5626..6643 /label=chimeric intron /note="chimera between introns from chicken beta-actin and rabbit beta-globin"
This page is informational only.