Basic Vector Information
- Vector Name:
- pZT90
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 4459 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Satoh K, Tu Z, Ohba H, Narumi I.
pZT90 vector Vector Map
pZT90 vector Sequence
LOCUS 40924_48608 4459 bp DNA circular SYN 18-DEC-2018 DEFINITION Expression vector pZT90 DNA, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 4459) AUTHORS Satoh K, Tu Z, Ohba H, Narumi I. TITLE Development of versatile shuttle vectors for Deinococcus grandis JOURNAL Plasmid 62 (1), 1-9 (2009) PUBMED 19504653 REFERENCE 2 (bases 1 to 4459) AUTHORS Narumi I. TITLE Direct Submission JOURNAL Submitted (15-DEC-2008) Contact:Issay Narumi Japan Atomic Energy Agency, Quantum Beam Science Directorate; 1233 Watanuki, Takasaki, Gunma 370-1292, Japan REFERENCE 3 (bases 1 to 4459) TITLE Direct Submission REFERENCE 4 (bases 1 to 4459) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid"; date: "2009"; volume: "62"; issue: "1"; pages: "1-9" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (15-DEC-2008) Contact:Issay Narumi Japan Atomic Energy Agency, Quantum Beam Science Directorate; 1233 Watanuki, Takasaki, Gunma 370-1292, Japan" COMMENT SGRef: number: 3; type: "Journal Article" FEATURES Location/Qualifiers source 1..4459 /mol_type="other DNA" /organism="synthetic DNA construct" CDS 205..1710 /codon_start=1 /gene="orf2" /label=orf2 /note="Orf2; similar to Deinococcus radiodurans plasmid pUE10 RepU" /protein_id="BAH03366.1" /translation="MAQKISREGGAGPAVHPNWQHPAGRRGAKVILEASQKCLQTPLIE PSHSEGPLPMNNQKQDSYTDRVRQIAPVVPLLDLIVKPLIPERAAPNPYLEMGLAALRG EPVDTRRAQVQPSKQFQKASRPAPAAPPLVLTSDQGEDQEAAMLLPEIVEETRRRLEKQ ARENRETRRAEQRARFHQLVTAPTDEAAPDFVPPVSLQEGRQPPSGSVRVTLPRPEVPG PAWGELSADAVLDSVPWLSKGARLVFRIMHMLAVAKAQDCRYPVIPNSAAFHTPQLLLA FVARYTTRHFRRLTNELEHAGVIDGGAHAAKVKTGIGTTRHLWDGSIWAVKLRPSTCDA YLSPEDWQHEWRDFQADLESGRTAKKLMSYLNTCEGLARQEHVLKTWAVNPNAKMTSLC LERTFQAEQKMTLQDTVYALPLIGELSELKQAGAIGNAASIISHALGDSHSRRFWCGLL WAATRNGSLEAFSAQLLRLLADVQESSELRNPGALFAARLRSA" gene 205..1710 /gene="orf2" /label=orf2 misc_feature 1778..2060 /note="region of low %G+C (36%); possibly involved in replication initiation" primer_bind complement(2123..2139) /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" rep_origin 2356..2944 /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" protein_bind 3232..3253 /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." promoter 3268..3298 /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind 3306..3322 /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." primer_bind 3330..3346 /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS complement(3498..4154) /label=CmR /note="chloramphenicol acetyltransferase" regulatory complement(4212..4240) /label=derived from Deinococcus radiodurans katA promoter /note="derived from Deinococcus radiodurans katA promoter" /regulatory_class="promoter" misc_feature 4288..4293 /label=EcoT22I site /note="EcoT22I site" regulatory complement(4379..4408) /label=derived from Deinococcus radiodurans groE promoter /note="derived from Deinococcus radiodurans groE promoter" /regulatory_class="promoter" primer_bind complement(4427..4443) /label=KS primer /note="common sequencing primer, one of multiple similar variants"
This page is informational only.