Price Information
| Cat No. | Plasmid Name | Availability | Add to cart |
|---|---|---|---|
| V001918 | pYC44 | In stock, 1 week for quality controls |
Buy one, get one free! |
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.
Basic Vector Information
- Vector Name:
- pYC44
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5915 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Host:
- Yeast
- Source/Author:
- Yanez Carrillo P, Castano Navarro I.
- Promoter:
- TEF
pYC44 vector Vector Map
Plasmid Protocol
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5. Store the plasmid at -20 ℃.
6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it
General Plasmid Transform Protocol
1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.
2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.
3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.
4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.
5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.
pYC44 vector Sequence
LOCUS 40924_47913 5915 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pYC44, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5915)
AUTHORS Yanez Carrillo P, Castano Navarro I.
TITLE Expression vectors for C-terminal fusions with fluorescent proteins
and epitope tags in C. glabrata
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5915)
AUTHORS Yanez Carrillo P, Castano Navarro I.
TITLE Direct Submission
JOURNAL Submitted (05-DEC-2014) Division de Biologia Molecular, Instituto
Potosino de Investigacion Cientifica y Tecnologica, Camino a la
Presa San Jose 2055 Col. Lomas 4 seccion, San Luis Potosi 78216,
Mexico
REFERENCE 3 (bases 1 to 5915)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5915)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(05-DEC-2014) Division de Biologia Molecular, Instituto Potosino de
Investigacion Cientifica y Tecnologica, Camino a la Presa San Jose
2055 Col. Lomas 4 seccion, San Luis Potosi 78216, Mexico"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5915
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 190..410
/label=URA3 promoter
CDS 411..1211
/codon_start=1
/label=URA3
/note="orotidine-5'-phosphate decarboxylase, required for
uracil biosynthesis"
/translation="MSKATYKERAATHPSPVAAKLFNIMHEKQTNLCASLDVRTTKELL
ELVEALGPKICLLKTHVDILTDFSMEGTVKPLKALSAKYNFLLFEDRKFADIGNTVKLQ
YSAGVYRIAEWADITNAHGVVGPGIVSGLKQAAEEVTKEPRGLLMLAELSCKGSLSTGE
YTKGTVDIAKSDKDFVIGFIAQRDMGGRDEGYDWLIMTPGVGLDDKGDALGQQYRTVDD
VVSTGSDIIIVGRGLFAKGRDAKVEGERYRKAGWEAYLRRCGQQN"
rep_origin complement(1343..1798)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 1943..1959
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 1966..1984
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind 2017..2033
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
misc_feature 2035..2068
/label=FRT sequence
/note="FRT sequence"
protein_bind complement(2035..2068)
/label=FRT (minimal)
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
3'UTR 2069..2357
/label=3'UTR of CTA1 orf in Candida glabrata BG2
/note="3'UTR of CTA1 orf in Candida glabrata BG2"
promoter 2398..2741
/label=TEF promoter
/note="Ashbya gossypii TEF promoter"
CDS 2765..3328
/codon_start=1
/label=NrsR
/note="nourseothricin acetyltransferase"
/translation="TTLDDTAYRYRTSVPGDAEAIEALDGSFTTDTVFRVTATGDGFTL
REVPVDPPLTKVFPDDESDDESDAGEDGDPDSRTFVAYGDDGDLAGFVVVSYSGWNRRL
TVEDIEVAPEHRGHGVGRALMGLATEFARERGAGHLWLEVTNVNAPAIHAYRRMGFTLC
GLDTALYDGTASDGEQALYMSMPCP"
terminator 3345..3542
/label=TEF terminator
/note="Ashbya gossypii TEF terminator"
protein_bind complement(3585..3618)
/label=FRT (minimal)
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
promoter complement(3655..3673)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(3694..3710)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(3718..3734)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(3742..3772)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(3787..3808)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(4096..4684)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4858..5715)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFFHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
promoter complement(5716..5820)
/label=AmpR promoter