Basic Vector Information
- Vector Name:
- pAMP1_B.gbk
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2984 bp
- Type:
- UNVERIFIED: Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Skowron PM, Zylicz-Stachula A.
pAMP1_B.gbk vector Map
pAMP1_B.gbk vector Sequence
LOCUS 62056_3015 2984 bp DNA circular SYN 02-OCT-2019 DEFINITION UNVERIFIED: Cloning vector pAMP1_B.gbk, complete sequence. ACCESSION MK606502 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2984) AUTHORS Skowron PM, Zylicz-Stachula A. TITLE Direct Submission JOURNAL Submitted (06-MAR-2019) University of Gdansk, Faculty of Chemistry, Wita Stwosza 63, Gdansk, Pomorskie 80-308, Poland REFERENCE 2 (bases 1 to 2984) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (06-MAR-2019) University of Gdansk, Faculty of Chemistry, Wita Stwosza 63, Gdansk, Pomorskie 80-308, Poland" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## GenBank staff is unable to verify sequence and/or annotation provided by the submitter. FEATURES Location/Qualifiers source 1..2984 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(247..903) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(904..1006) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(1532..2077) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(2264..2974) /codon_start=1 /label=lambda repressor /note="phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG"
This page is informational only.