Basic Vector Information
- Vector Name:
- pAMP1_C
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 2986 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Skowron PM, Zylicz-Stachula A.
pAMP1_C vector Vector Map
pAMP1_C vector Sequence
LOCUS 62056_3020 2986 bp DNA circular SYN 02-OCT-2019 DEFINITION Cloning vector pAMP1_C, complete sequence. ACCESSION MK606506 VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 2986) AUTHORS Skowron PM, Zylicz-Stachula A. TITLE Direct Submission JOURNAL Submitted (07-MAR-2019) University of Gdansk, Faculty of Chemistry, Wita Stwosza 63, Gdansk, Pomorskie 80-308, Poland REFERENCE 2 (bases 1 to 2986) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Submitted (07-MAR-2019) University of Gdansk, Faculty of Chemistry, Wita Stwosza 63, Gdansk, Pomorskie 80-308, Poland" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..2986 /mol_type="other DNA" /organism="synthetic DNA construct" CDS complement(249..905) /codon_start=1 /label=CmR /note="chloramphenicol acetyltransferase" /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA" promoter complement(906..1008) /label=cat promoter /note="promoter of the E. coli cat gene encoding chloramphenicol acetyltransferase" rep_origin complement(1534..2079) /direction=LEFT /label=p15A ori /note="Plasmids containing the medium-copy-number p15A origin of replication can be propagated in E. coli cells that contain a second plasmid with the ColE1 origin." CDS complement(2266..2976) /codon_start=1 /label=lambda repressor /note="phage lambda repressor" /translation="MSTKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQ SGVGALFNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVSMQPSLRSEYEY PVFSHVQAGMFSPELRTFTKGDAERWVSTTKKASDSAFWLEVEGNSMTAPTGSKPSFPD GMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSV VGKVIASQWPEETFG"
This page is informational only.