Basic Vector Information
- Vector Name:
- pKD233.7-3
- Antibiotic Resistance:
- Tetracycline
- Length:
- 5437 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
pKD233.7-3 vector Map
pKD233.7-3 vector Sequence
LOCUS 40924_26601 5437 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pKD233.7-3, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5437)
AUTHORS Landry BP, Palanki R, Dyulgyarov N, Hartsough LA, Tabor JJ.
TITLE Phosphatase activity tunes two-component system sensor detection
threshold
JOURNAL Nat Commun 9 (1), 1433 (2018)
PUBMED 29650958
REFERENCE 2 (bases 1 to 5437)
AUTHORS Landry BP.
TITLE Direct Submission
JOURNAL Submitted (29-OCT-2017) Bioengineering, Rice University, 6100 Main
St, Houston, TX 77005, USA
REFERENCE 3 (bases 1 to 5437)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5437)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat
Commun"; date: "2018"; volume: "9"; issue: "1"; pages: "1433"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(29-OCT-2017) Bioengineering, Rice University, 6100 Main St,
Houston, TX 77005, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5437
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature complement(1..6)
/label=AvrII Scar
/note="AvrII Scar"
rep_origin complement(151..739)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(763..815)
/label=Tn3 Artifact
/note="Tn3 Artifact"
misc_feature complement(815..820)
/label=SpeI Scar
/note="SpeI Scar"
terminator complement(827..921)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
misc_feature complement(927..932)
/label=SacI Scar
/note="SacI Scar"
CDS complement(945..1601)
/label=CmR
/note="chloramphenicol acetyltransferase"
promoter complement(1602..1704)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
regulatory 1730..1764
/label=constitutive promoter J23114
/note="constitutive promoter J23114"
/regulatory_class="promoter"
regulatory 1772..1785
/label=RBS pprotet
/note="RBS pprotet"
/regulatory_class="ribosome_binding_site"
regulatory 1774..1785
/label=B0034
/note="B0034"
/regulatory_class="ribosome_binding_site"
RBS 1774..1785
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 1793..2500
/label=mCherry
/note="monomeric derivative of DsRed fluorescent protein
(Shaner et al., 2004)"
misc_feature 2504..2507
/label=Scar
/note="Scar"
regulatory 2508..2559
/label=L3S1P52
/note="L3S1P52"
/regulatory_class="terminator"
misc_feature 2560..2563
/label=Scar
/note="Scar"
misc_feature 2585..2635
/label=E. coli LacZ Upstream
/note="E. coli LacZ Upstream"
misc_feature 2637..2642
/label=XhoI Scar
/note="XhoI Scar"
promoter 2643..2716
/label=PLtetO-1 promoter
/note="modified phage lambda PL promoter with tet operator
sites (Lutz and Bujard, 1997)"
regulatory 2717..2751
/label=sRBS (1087.31)
/note="sRBS (1087.31)"
/regulatory_class="ribosome_binding_site"
CDS 2752..3372
/codon_start=1
/product="Sbal195_3858 (TtrR)"
/label=Sbal195_3858
/protein_id="AWU50974.1"
/translation="MSLALPVYLIDDDDSVRRSLRFMLESYGLKITDFDSAEAFFTAVD
LTLPGCALVDVRMPGLSGPQLHLELVSKNSPLAVIYLTGHGDVPMAVEALKLGAVDFFQ
KPADGAKLAEAVVKALEHAKTHYQDNQYLETYQALTPREREILNLIAQGLKNQEIADNL
CIAMRTVEIHRANLMKGMQVGSLAEMMLIYSRIAERLRLEDNR"
misc_feature 2914..2916
/label=D55
/note="D55"
terminator 3390..3461
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature 3462..3469
/label=BB Scar
/note="BB Scar"
terminator 3477..3504
/label=T7Te terminator
/note="phage T7 early transcription terminator"
misc_feature 3511..3615
/label=Ptrp Fragment
/note="Ptrp Fragment"
regulatory 3628..3712
/label=Psbal195_3860 (185-269)
/note="Psbal195_3860 (185-269)"
/regulatory_class="promoter"
misc_feature 3630..3653
/label=Actual repeat
/note="Actual repeat"
misc_feature 3630..3634
/label=Repeat
/note="Repeat"
misc_feature 3635..3648
/label=Fnr
/note="Fnr"
misc_feature 3642..3653
/label=Repeat
/note="Repeat"
misc_feature complement(3646..3650)
/label=Repeat
/note="Repeat"
regulatory 3650..3655
/regulatory_class="minus_35_signal"
regulatory 3676..3681
/regulatory_class="minus_10_signal"
misc_feature 3688
/label=+1
/note="+1"
misc_feature 3697..3703
/label=Repeat
/note="Repeat"
misc_feature complement(3709..3715)
/label=Repeat
/note="Repeat"
regulatory 3713..3730
/label=BBa_B0034
/note="BBa_B0034"
/regulatory_class="ribosome_binding_site"
RBS 3713..3724
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 3731..4444
/label=superfolder GFP
/note="GFP variant that folds robustly even when fused to
poorly folded proteins (Pedelacq et al., 2006)"
regulatory 4463..4591
/label=B0015
/note="B0015"
/regulatory_class="terminator"
regulatory 4463..4542
/label=B0010
/note="B0010"
/regulatory_class="terminator"
terminator 4471..4542
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
misc_feature 4543..4550
/label=BB Scar
/note="BB Scar"
regulatory 4551..4591
/label=B0012
/note="B0012"
/regulatory_class="terminator"
terminator 4558..4585
/label=T7Te terminator
/note="phage T7 early transcription terminator"
misc_feature 4592..4636
/label=pUC MCS
/note="pUC MCS"
regulatory 4637..4671
/label=constitutive promoter J23106
/note="constitutive promoter J23106"
/regulatory_class="promoter"
regulatory 4672..4705
/label=sRBS (50,000)
/note="sRBS (50,000)"
/regulatory_class="ribosome_binding_site"
CDS 4706..5329
/label=TetR
/note="tetracycline repressor TetR"
terminator 5338..5424
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.