Basic Vector Information
AAV packaging plasmid, expressing Rep2 and Cap5
- Vector Name:
- pAAV2/5
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7371 bp
- Type:
- Viral Expression & Packaging Vectors
- Replication origin:
- ori
- Copy Number:
- High copy number
- Promoter:
- P5
- Growth Strain(s):
- NEB Stable
- Growth Temperature:
- 37℃
pAAV2/5 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pAAV2/5 vector Sequence
LOCUS 40924_3232 7371 bp DNA circular SYN 21-AUG-2023 DEFINITION synthetic circular DNA. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 7371) AUTHORS . TITLE Direct Submission FEATURES Location/Qualifiers source 1..7371 /mol_type="other DNA" /organism="synthetic DNA construct" primer_bind 98..114 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" CDS complement(377..2551) /codon_start=1 /label=capsid protein from AAV5 /translation="MSFVDHPPDWLEEVGEGLREFLGLEAGPPKPKPNQQHQDQARGLV LPGYNYLGPGNGLDRGEPVNRADEVAREHDISYNEQLEAGDNPYLKYNHADAEFQEKLA DDTSFGGNLGKAVFQAKKRVLEPFGLVEEGAKTAPTGKRIDDHFPKRKKARTEEDSKPS TSSDAEAGPSGSQQLQIPAQPASSLGADTMSAGGGGPLGDNNQGADGVGNASGDWHCDS TWMGDRVVTKSTRTWVLPSYNNHQYREIKSGSVDGSNANAYFGYSTPWGYFDFNRFHSH WSPRDWQRLINNYWGFRPRSLRVKIFNIQVKEVTVQDSTTTIANNLTSTVQVFTDDDYQ LPYVVGNGTEGCLPAFPPQVFTLPQYGYATLNRDNTENPTERSSFFCLEYFPSKMLRTG NNFEFTYNFEEVPFHSSFAPSQNLFKLANPLVDQYLYRFVSTNNTGGVQFNKNLAGRYA NTYKNWFPGPMGRTQGWNLGSGVNRASVSAFATTNRMELEGASYQVPPQPNGMTNNLQG SNTYALENTMIFNSQPANPGTTATYLEGNMLITSESETQPVNRVAYNVGGQMATNNQSS TTAPATGTYNLQEIVPGSVWMERDVYLQGPIWAKIPETGAHFHPSPAMGGFGLKHPPPM MLIKNTPVPGNITSFSDVPVSSFITQYSTGQVTVEMEWELKKENSKRWNPEIQYTNNYN DPQFVDFAPDSTGEYRTTRPIGTRYLTRPL" CDS complement(2571..4430) /gene="Rep78" /label=Rep78 /note="Protein Rep78 from Adeno-associated virus 2 (isolate Srivastava/1982). Accession#: Q89268" protein_bind complement(4593..4640) /label=FRT /note="FLP-mediated recombination occurs in the 8-bp core sequence TCTAGAAA (Turan and Bode, 2011)." primer_bind complement(4654..4670) /label=SK primer /note="common sequencing primer, one of multiple similar variants" primer_bind complement(4720..4736) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" protein_bind complement(4744..4760) /label=lac operator /note="The lac repressor binds to the lac operator to inhibit transcription in E. coli. This inhibition can be relieved by adding lactose or isopropyl-beta-D-thiogalactopyranoside (IPTG)." promoter complement(4768..4798) /label=lac promoter /note="promoter for the E. coli lac operon" protein_bind complement(4813..4834) /label=CAP binding site /note="CAP binding activates transcription in the presence of cAMP." rep_origin complement(5122..5710) /direction=LEFT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication" CDS complement(5884..6741) /label=AmpR /note="beta-lactamase" promoter complement(6742..6846) /label=AmpR promoter rep_origin 6873..7328 /label=f1 ori /note="f1 bacteriophage origin of replication; arrow indicates direction of (+) strand synthesis"
This page is informational only.